Search or add a thesis

Advanced Search (Beta)
Home > Efficient Hardware Design of Elliptic Curve Point Multiplication Accelerators

Efficient Hardware Design of Elliptic Curve Point Multiplication Accelerators

Thesis Info

Access Option

External Link

Author

Shah, Yasir Ali

Program

PhD

Institute

COMSATS University Islamabad

City

Islamabad

Province

Islamabad.

Country

Pakistan

Thesis Completing Year

2019

Thesis Completion Status

Completed

Subject

Electrical Engineering

Language

English

Link

http://prr.hec.gov.pk/jspui/bitstream/123456789/10971/1/Yasir%20Ali%20Shah_EE_2019_Comsats_PRR.pdf

Added

2021-02-17 19:49:13

Modified

2024-03-24 20:25:49

ARI ID

1676727745133

Asian Research Index Whatsapp Chanel
Asian Research Index Whatsapp Chanel

Join our Whatsapp Channel to get regular updates.

Similar


In recent years, the evolution of technology has broadened the avenues of information sharing. The volume of sensitive and important information being exchanged over the insecuremediumhasincreaseddramatically. Ellipticcurvecryptography(ECC)hasbecomewidelyacceptedasanefficientmechanismtosecureprivatedatausingpublic-key protocols. The pivotal operation within ECC based crypto-systems is scalar point multiplication which is computationally expensive. Point multiplication can be achieved by iterative execution of point addition and point doubling groups operations which in turn are based on finite field arithmetic operations such as addition, subtraction, multiplication and division. These finite field arithmetic operations, especially the finite field multiplication are the bottleneck of any ECC based crypto-system. To reduce the computational cost of point multiplication operation, by optimizing these finite field arithmetic operations, is an active area of research. Efficient hardware implementations of Elliptic Curve Point Multipliers (ECPM) over several new platforms have been in the focal point of major research efforts for the last two decades. Field Programmable gate arrays (FPGA) due to its reconfigurable nature and less development time has become a very popular choice for hardware implementationofcryptographicalgorithms. ECPMarchitecturesonFPGAeitheronlyuseLook Up Tables (LUTs) or have utilized embedded Digital signal processing (DSP) blocks along with the LUTs. LUTs-only based designs are portable designs since they can be translated to any FPGA family or standard cell based Application Specific Integrated Circuits(ASIC).However,existingLUTsbaseddesignsareslowersincetheyarebased on finite field arithmetic components which have longer critical path delay and higher clock cycles consumption. DSP based ECPM designs may offer better performance at the cost of increased area. However, DSP based designs have portability issues. The prime objective of this dissertation is to design LUTs based high speed ECPM architectures. ThebottomlayerFp arithmeticoperationsespeciallytheFp multiplication are first optimized at both circuit level and architectural level. Subsequently, based on these optimized finite field arithmetic primitives, and by devising an efficient schedul ing strategy for elliptic curve group operations, this dissertation achieves high speed hardware architectures to perform elliptic curve point multiplication. Inthefirstcontribution,anovelhighspeedRedundant-Signed-Digit(RSD)basedECPM architecture for arbitrary curves over a general prime field is designed. It is based on a new high speed finite field multiplier architecture which employs different parallel computation techniques at both circuit level and architectural level. As a result of these optimizationstrategies,theproposedmultiplieroffersasignificantreductionincomputation time over the state-of-the-art. An efficient scheduling strategy is devised for PA andPDgroupoperationswhichreducedtherequirednumberofclockcyclesforECPM design. The ECPM architecture designed in this dissertation offers higher speed and lower area-time product than recent state-of-the-art ECPM designs. In the second contribution of this dissertation, an ECPM architecture for low area applications is developed. The ECPM design utilizes fewer resources while maintaining the competitive speed with other state-of-the-art ECPMs. The finite field multiplier developed in this dissertation offers lower area-time product than recent contemporary designs. Basedonthisfinitefieldmultiplierandapipelinedfinitefieldadder/subtractor, an ECPM architecture is designed that offers lower area-time product than recent stateof-the-art ECPM designs. The third contribution presents a high speed ECPM architecture for National Institute of Standards and Technology (NIST) recommended primes. Different strategies such as RSD representation, segmentation and pipelining are used to reduce the critical path delayandrequirednumberofclockcyclesforthefinitefieldarithmeticprimitives. The implementation results demonstrate that the proposed ECPM architecture outperforms other state-of-the-art designs in terms of speed and area-time product metrics. Finally, an ECPM architecture for the Curve448 is developed in the last contribution of this dissertation. Curve448 is recently recommended by the Internet Engineering Task Force (IETF) for future cryptography. The only existing ECPM architecture over the Curve448isaDSPbaseddesignandlacksportability. TheECPMarchitecturedesigned inthisdissertationisthefirstLUTsbasedimplementationfortheCurve448. Thedesign is optimized with a focus on both performance and resource utilization. A comparison with the state-of-the-art ECPM designs shows that ECPM design in this dissertation provides higher speed and can be adopted in time-critical applications.
Loading...
Loading...

Similar Books

Loading...

Similar Chapters

Loading...

Similar News

Loading...

Similar Articles

Loading...

Similar Article Headings

Loading...

ملا طاہر سیف الدین

ملا طاہر سیف الدین
گذشتہ دو مہینوں میں مسلمانوں کے دو بڑے قومی حادثے ہوئے، ۵؍ نومبر کو داؤدی بوہرون کے امام ملا طاہر سیف الدین نے انتقال کیا، ان کی ذات جامع صفات تھی، بڑے ذی علم، دیندار، فیاض و مخیر اور وسیع القلب تھے، دینی علوم پر ان کی نگاہ بہت وسیع تھی، اس لحاظ سے وہ ہندوستان کے ممتاز علماء میں تھے، صاحبِ قلم بھی تھے، عربی میں ان کی کئی تصانیف ہیں، انھوں نے اپنے دور میں نہ صرف اپنے فرقہ کی بڑی تعلیمی و اقتصادی خدمت کی بلکہ دوسرے اسلامی فرقوں کے ساتھ بھی ان کا سلوک روادرانہ و فیاضانہ تھا، اور ان کو ایک دوسرے کے قریب لانے کی کوشش کی، مسلم یونیورسٹی کے تو چانسلر ہی تھے، اس کو وقتاً فوقتاً بڑی بڑی رقمیں دیتے رہتے تھے، دارالمصنفین کی جوبلی کے موقع پر اس کو بارہ ہزار کا عطیہ دیا، اس لیے ہر فرقہ کے مسلمانوں میں عزت و وقعت کی نظر سے دیکھے جاتے تھے، اﷲ تعالیٰ ان کے حسنات کے طفیل میں ان کی مغفرت فرمائے، دارالمصنفین اس حادثہ میں ان کے لائق جانشین ملا برہان الدین کا شریک غم ہے اور دعا ہے کہ خدا ان کو ان کے باعظمت والد کے نقش قدم پر چلنے کی توفیق عطا فرمائے۔ (شاہ معین الدین ندوی، دسمبر ۱۹۶۵ء)

 

PEMBELAJARAN NILAI NILAI KARAKTER ISLAM MODERAT DI PERGURUAN TINGGI

This study discusses how to integrate the values ​​of moderate Islamic character in Islamic higher education institutions. Integration of the value of moderate Islamic character values ​​can be implemented through learning in all subjects in Islamic higher education. Integration of Islamic character values ​​can be done on all subjects in Islamic higher education by referring to the concepts, systems and theories of learning. Learning the value of moderate Islamic characters can give students a personality color better than before and can inspire lecturers as learners. In carrying out enlightenment and intelligence in shaping tough, courageous, honest, tolerant, responsible and consistent students, in order to answer the challenges of powerlessness and inability to build national identity, inability to reconstruct the nation's potential responsively and dynamically. The hope of the writer, with the integration of the value of moderate Islamic character in all courses in Islamic higher education, can be the basis for the formation of adherent behavior, and the value of character can be a declarator of glory on the face of the earth

Molecular Analysis of Group a Rotaviruses in Hospitalized Pakistani Children During 2014-2016

Group A rotavirus (RVA) is the leading cause of diarrhea in children <5 years in many countries. The objectives of this pre-vaccination era study were to explore the prevalence and the genetic diversity of RVA strains in <5 years children, hospitalized due to gastroenteritis during 2014 – 2016. Two tertiary care hospitals Benazir Bhutto Hospital (BBH) located in Rawalpindi and Kharadar General Hospital (KGH) in Karachi were the study sites. A total of 1227 children were tested through ELISA for the presence of RVA and 28.5% (n=350) were found positive. From the 956 children enrolled in BBH (n=502 in 2014 and n=454 in 2015), 29.1% (n=279) were RVA positive. Among the 271 children enrolled in KGH during 2016, 26% (n=71) were found to be infected with RVA. A majority (78%; n=272) of RVA gastroenteritis cases were found in children <1 year of age and the virus was detected throughout the study period. Genotyping of ELISA positive samples through RT-PCR showed G12P[6] (21%) as the most dominant genotype followed by G3P[8] (16%), G2P[4] (12%), G1P[8] (9%), G9P[6] (8%) and G3P[6] (6%). A high proportion (10%) of mixed infection was also observed. Phylogenetic analysis clustered Pakistani G1 strains into two lineages, G1 lineage 1 & 2 along with strains from Russia, Australia, Thailand, India, Bhutan, Belgium Turkey, and the USA. The G2 strains clustered into G2 lineage IV, sub lineage IVa-3 along with strains reported worldwide. Pakistani G2 strains showed the D96N and S242N substitutions which are characteristic of sub-lineage IVa-3 and have been linked to the reemergence of these strains in many countries. Pakistan G3 viruses clustered into G3 lineage 3, sub-lineage 3d and were closely related to strains from China, Russia, Japan, and the USA. High amino acid similarities existed among indigenous G3 and the new variant G3 viruses that were first reported from Japan in 2003-2004. We hereby report the first finding of these variant G3 viruses from our country. The G9 strains grouped into two lineages G9 lineage 3 & 4 with the majority of strains belonging to lineage 3. Pakistani G12 strains belonged to the G12 lineage 3 together with G12 from different countries. The P[4], P[6] and P[8] Pakistani strains were linked to VP4 genotypes found globally. Comparative analysis of wild-type rotaviruses with RotarixTM and RotaTeqTM revealed several amino acid differences in the VP7 and VP8* antigenic epitopes. Notably, Pakistani G3 isolates contained a K238N amino acid change that generates an extra N linked glycosylation site which could have an effect on the antigenicity of these strains. This is the first report on the predominance of G12P[6] and the emergence of G3P[8] from Pakistan. Our findings provide important information pertinent to the genetic diversity of RVA strains circulating in the two cities of Pakistan (Rawalpindi and Karachi) and emphasize the need for large-scale epidemiological studies across the country.